HORDB

ID: hor004395
Uniprot ID: Q9UHF0
Protein name: Neurokinin-B
Gene name: TAC3
Organism: Homo sapiens (Human)
Family: Tachykinin family
Source: Human
Expression: In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hy
Disease: Diseases associated with TAC3 include Hypogonadotropic Hypogonadism 10 With Or Without Anosmia and Infertility.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005515 protein binding
GO BP: GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0045777 positive regulation of blood pressure
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: DMHDFFVGLM
Length: 10
Propeptide: MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Signal peptide: MRIMLLFTAILAFSLA
Modification: T10 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Function: Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function.
Mechanism: NA
Cross BBB: NA
Target: TACR3
Target Unid: P29371
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

1p9f.pdb

hor004395_AF2.pdb

hor004395_ESM.pdb

Mass:	137214	Formula:	C55H78N12O15S2
Absent amino acids:	ACEIKNPQRSTWY	Common amino acids:	DFM
pI:	4.11	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	4
Hydrophobicity:	68	Boman Index:	-154
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	68
Instability Index:	5025	Extinction Coefficient cystines:	0
Absorbance 280nm:	0